PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00964.1_g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 293aa    MW: 32120.6 Da    PI: 6.6377
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00964.1_g00023.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.42.8e-17136183350
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                              +lkr rr+++NRe+ArrsR+RK+++++ Le  v++L++eN++L k+l 
  Rsa1.0_00964.1_g00023.1 136 ALKRMRRMYSNRESARRSRRRKQEQLADLESQVDSLKGENSTLYKQLI 183
                              79*****************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.6E-12129183No hitNo description
SMARTSM003387.3E-12134198IPR004827Basic-leucine zipper domain
PfamPF001702.8E-15136182IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921136182IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.13E-12137184No hitNo description
PROSITE patternPS000360141156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MDGHTAKDTG MKRSASELAL QEYLTKVLSS SALSRQESSL DTNPLDPSFV PMNKDHTGEV  60
RDSHLLSESL IPAGFLLDAQ SSICENLSAD SPVSANKPEV RRRARRTASV STHDRSDEED  120
AETEAGQSEM TNDPNALKRM RRMYSNRESA RRSRRRKQEQ LADLESQVDS LKGENSTLYK  180
QLIDATQLFR SAGTNNRILK SDVETLRIKV KLAEDLVARG SFTSSLNQLL QTHLRPSPQS  240
TNSLHYTGST SPAVTVHSDQ SMLPGITLSG QNSSTGLGNV SSEAVSCVSD IWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150157RRSRRRKQ
2152157SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598287.10.0PREDICTED: basic leucine zipper 9
SwissprotQ9FUD31e-160BZIP9_ARATH; Basic leucine zipper 9
TrEMBLA0A0D3DD030.0A0A0D3DD03_BRAOL; Uncharacterized protein
STRINGBra009793.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-144basic leucine zipper 9